PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G211600.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 271aa    MW: 30972.4 Da    PI: 8.057
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G211600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.81.6e-26129178352
              RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ++i+l ++++yF+lpi++A+k+L++++++LKr+CR+yGI+RWPhRkiksl
  Sevir.7G211600.2.p 129 DSITLVEIAQYFHLPIREASKTLKIGVSILKRKCRKYGIPRWPHRKIKSL 178
                         689*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.577113198IPR003035RWP-RK domain
PfamPF020421.1E-21130178IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MAGWRGRPVF REGQTVGTWR CIVAFDSVAA VKPSSPPPPV LSPLVNPQLE CLPNLYKDLQ  60
KVFQFQKVEK VPRRVLRDAK EQPIHSGEQE KTSDEADSSG SDSDGDTQSD KELAPSVQKQ  120
PRANRKHIDS ITLVEIAQYF HLPIREASKT LKIGVSILKR KCRKYGIPRW PHRKIKSLDS  180
LIQDLEYVLE DDPEEDGQQE LLQMEEEKQA AAIKALTKRK KMLESEKETL QQKPALDLMT  240
ETKQFRDDVF KRRYRAKSAA IDMEMEMETE *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976506.10.0PREDICTED: protein RKD5
TrEMBLK3Y9E51e-136K3Y9E5_SETIT; Uncharacterized protein
STRINGSi010837m1e-135(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.11e-36RWP-RK domain-containing protein